CacheBy
Atlas Antibodies Anti-RNF165 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RNF165 Antibody

상품 한눈에 보기

Human RNF165 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. 인간에서 검증된 반응성, 높은 종간 서열 일치율 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047798-100 Anti-RNF165 Antibody, ring finger protein 165 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047798-25 Anti-RNF165 Antibody, ring finger protein 165 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RNF165 Antibody

Anti-RNF165 Antibody

Target Information

  • Target Protein: Ring finger protein 165
  • Target Gene: RNF165
  • Alternative Gene Names: ARKL2, RNF111L2

Product Description

Polyclonal antibody against human RNF165, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ALHQQYLLQQQLLEAQHRRLVSHPRRSQERVSVHPHRLHPSFDFGQLQTPQPRYLAEGTDWDLSVDAGLSPAQFQVRPIPQHYQHYLATPRMHHFPRNSSSTQ

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000025427 (97%)
  • Rat ENSRNOG00000048824 (96%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Recommended Applications IHC, ICC
Verified Reactivity Human
Alternative Gene Names ARKL2, RNF111L2

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.