CacheBy
Atlas Antibodies Anti-RND2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RND2 Antibody

상품 한눈에 보기

Human RND2 단백질을 인식하는 토끼 폴리클로날 항체로, Rho family GTPase 2 연구에 적합. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077757-100 Anti-RND2 Antibody, Rho family GTPase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077757-25 Anti-RND2 Antibody, Rho family GTPase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RND2 Antibody

Anti-RND2 Antibody

Target Information

  • Target Protein: Rho family GTPase 2
  • Target Gene: RND2
  • Alternative Gene Names: ARHN, Rho7, RhoN

Product Description

Polyclonal antibody against human RND2.
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence used as immunogen.

Antigen Sequence

GCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000001313 (100%)
  • Rat ENSRNOG00000020698 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Immunohistochemistry (IHC)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.