
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RMDN3 Antibody
상품 한눈에 보기
Human RMDN3 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC, WB, ICC 응용에 적합하며 PrEST 항원으로 친화 정제됨. Human 반응성 검증 완료, 고순도 IgG 형태로 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA074840-100 Anti-RMDN3 Antibody, regulator of microtubule dynamics 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074840-25 Anti-RMDN3 Antibody, regulator of microtubule dynamics 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RMDN3 Antibody
Anti-RMDN3 Antibody
Target Information
- Target Protein: Regulator of Microtubule Dynamics 3
- Target Gene: RMDN3
- Alternative Gene Names: FAM82A2, FAM82C, FLJ10579, PTPIP51, RMD3
Product Description
Polyclonal antibody against human RMDN3.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
DEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCG
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000049007 | 84% |
| Mouse | ENSMUSG00000070730 | 80% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Recommended Applications | IHC, WB, ICC |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



