CacheBy
Atlas Antibodies Anti-RHPN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RHPN1 Antibody

상품 한눈에 보기

인간 RHPN1 단백질을 인식하는 폴리클로날 항체. 면역조직화학(IHC) 및 면역세포화학(ICC) 실험에 적합. 토끼 유래 IgG 항체로 PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증된 반응성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024671-100 Anti-RHPN1 Antibody, rhophilin, Rho GTPase binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024671-25 Anti-RHPN1 Antibody, rhophilin, Rho GTPase binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RHPN1 Antibody

Anti-RHPN1 Antibody

Target Protein: rhophilin, Rho GTPase binding protein 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RHPN1.


Alternative Gene Names

KIAA1929, ODF5, RHPN

Open Datasheet (PDF)


Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EVVTELKAAGEAGASLQVVSLLPSSRLPSLGDRRPVLLGPRGLLRSQREHGCKTPASTWASPRPLLNWSRKAQQGKTGGCPQPCAPVKPAP

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000022580 49%
Rat ENSRNOG00000007597 46%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.