AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RHOT2 Antibody
상품 한눈에 보기
인간 RHOT2 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. ARHT2, MIRO-2 등의 대체 유전자명으로도 알려져 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADBIX 2026 전시회10/28~30 코엑스 · 사전등록 안내자세히보기Atlas Antibodies HPA012624-100 Anti-RHOT2 Antibody, ras homolog family member T2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012624-25 Anti-RHOT2 Antibody, ras homolog family member T2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RHOT2 Antibody
Anti-RHOT2 Antibody
Target Information
- Target Protein: ras homolog family member T2
- Target Gene: RHOT2
- Alternative Gene Names: ARHT2, C16orf39, MIRO-2
Product Description
Polyclonal Antibody against Human RHOT2.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
RSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGACGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILC
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000093593 | 77% |
| Rat | ENSRNOG00000019930 | 75% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.