CacheBy
Atlas Antibodies Anti-RHBDD3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RHBDD3 Antibody

상품 한눈에 보기

Human RHBDD3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 재조합 발현 검증을 완료했습니다. 40% 글리세롤 PBS 완충액에 보존되어 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043979-100 Anti-RHBDD3 Antibody, rhomboid domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043979-25 Anti-RHBDD3 Antibody, rhomboid domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RHBDD3 Antibody

Anti-RHBDD3 Antibody

Target Protein: rhomboid domain containing 3
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, recombinant expression validation using target protein overexpression)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human RHBDD3.


Alternative Gene Names

C22orf3, PTAG

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein rhomboid domain containing 3
Target Gene RHBDD3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSL
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000034175 (66%), Rat ENSRNOG00000027032 (62%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.