CacheBy
Atlas Antibodies Anti-RFWD3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RFWD3 Antibody

상품 한눈에 보기

Human RFWD3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human 종에 반응하며, 안정한 PBS/glycerol buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA075649-100 Anti-RFWD3 Antibody, ring finger and WD repeat domain 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075649-25 Anti-RFWD3 Antibody, ring finger and WD repeat domain 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RFWD3 Antibody

Anti-RFWD3 Antibody

Target: Ring finger and WD repeat domain 3 (RFWD3)
Supplier: Atlas Antibodies


ICC (Immunocytochemistry)


Product Description

Polyclonal antibody against Human RFWD3


Alternative Gene Names

  • FLJ10520
  • RNF201

Open Datasheet


Target Information

항목 내용
Target Protein Ring finger and WD repeat domain 3
Target Gene RFWD3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000033596 (61%), Rat ENSRNOG00000003875 (21%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

RLQRRVQDLQKLTSHQSQNLQQPRGSQAWVLSCSPSSQGQHKHKYHFQKTFTVSQAGNCRIMAYCDALSCLVISQPSPQASFLPGFGVKML

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.