
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RFC4 Antibody
상품 한눈에 보기
Human RFC4 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent validation으로 높은 신뢰성 보장. Rabbit 유래 IgG, Affinity purification 방식으로 제조.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049123-100 Anti-RFC4 Antibody, replication factor C (activator 1) 4, 37kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049123-25 Anti-RFC4 Antibody, replication factor C (activator 1) 4, 37kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RFC4 Antibody
Anti-RFC4 Antibody
Target Protein: replication factor C (activator 1) 4, 37kDa
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Independent validation): Protein expression validated by comparing independent antibodies targeting different epitopes of the protein.
- ICC: Suitable for immunocytochemistry.
Product Description
Polyclonal Antibody against Human RFC4
Alternative Gene Names
A1, RFC37
Datasheet
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | replication factor C (activator 1) 4, 37kDa |
| Target Gene | RFC4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIP |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000001816 (91%), Mouse ENSMUSG00000022881 (90%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety Info | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



