CacheBy
Atlas Antibodies Anti-RFC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RFC4 Antibody

상품 한눈에 보기

Human RFC4 단백질을 표적으로 하는 폴리클로날 토끼 항체. IHC, WB, ICC 등 다양한 응용에 사용 가능. Orthogonal 및 Independent validation으로 검증된 신뢰성 높은 항체. Affinity purification으로 높은 특이성과 재현성 제공.

카탈로그번호
HPA058507-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058507-100 Anti-RFC4 Antibody, replication factor C (activator 1) 4, 37kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058507-25 Anti-RFC4 Antibody, replication factor C (activator 1) 4, 37kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RFC4 Antibody

Anti-RFC4 Antibody

Target: replication factor C (activator 1) 4, 37kDa
Type: Polyclonal Antibody against Human RFC4


  • IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody generated in rabbit against human RFC4 (Replication Factor C subunit 4).
Validated for use in multiple applications through orthogonal and independent validation strategies.


Alternative Gene Names

A1, RFC37

Open Datasheet (PDF)


Antigen Information

Target Protein: replication factor C (activator 1) 4, 37kDa
Target Gene: RFC4
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

RIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIP

Species Reactivity

Verified Species Reactivity
Human Verified
Rat 91% sequence identity (ENSRNOG00000001816)
Mouse 90% sequence identity (ENSMUSG00000022881)

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Independent
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.