AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-REG1A Antibody
상품 한눈에 보기
Human REG1A 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. RNA-seq 데이터 기반의 직교 검증을 통해 단백질 발현을 확인하였습니다. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA045579-100 Anti-REG1A Antibody, regenerating islet-derived 1 alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045579-25 Anti-REG1A Antibody, regenerating islet-derived 1 alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-REG1A Antibody
Anti-REG1A Antibody
regenerating islet-derived 1 alpha
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot)
Product Description
Polyclonal Antibody against Human REG1A
Alternative Gene Names
PSP, PSPS, PSPS1, PTP, REG
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | regenerating islet-derived 1 alpha |
| Target Gene | REG1A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSV |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000059654 (82%), Rat ENSRNOG00000006486 (74%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.