
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RDH8 Antibody
상품 한눈에 보기
Human RDH8 단백질을 인식하는 rabbit polyclonal antibody로, retinol dehydrogenase 8(all-trans)에 특이적입니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 적합합니다. PBS/glycerol buffer 기반으로 안정적 보관이 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA064473-100 Anti-RDH8 Antibody, retinol dehydrogenase 8 (all-trans) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064473-25 Anti-RDH8 Antibody, retinol dehydrogenase 8 (all-trans) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RDH8 Antibody
Anti-RDH8 Antibody
Target Information
- Target Protein: Retinol dehydrogenase 8 (all-trans)
- Target Gene: RDH8
- Alternative Gene Names: PRRDH, SDR28C2
Product Description
Polyclonal antibody against human RDH8.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000025767 (75%)
- Mouse ENSMUSG00000053773 (72%)
Recommended Applications
ICC (Immunocytochemistry)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Verified Species Reactivity | Human |
| Recommended Applications | ICC |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
- Material Safety Data Sheet
- Open Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



