CacheBy
Atlas Antibodies Anti-RCOR3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RCOR3 Antibody

상품 한눈에 보기

Human RCOR3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. REST corepressor 3 단백질 발현 검증에 활용됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA071997-100 Anti-RCOR3 Antibody, REST corepressor 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071997-25 Anti-RCOR3 Antibody, REST corepressor 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RCOR3 Antibody

Anti-RCOR3 Antibody

REST corepressor 3

  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human RCOR3

Alternative Gene Names

  • FLJ10876

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein REST corepressor 3
Target Gene RCOR3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RSRTSLMDRQARKLANRHNQGDSDDDVEETHPMDGNDSDYDPKKEAKKEGNTEQPVQTSKIGLGRREYQSLQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAANT

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000046445 (97%)
  • Mouse ENSMUSG00000111452 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.