AI 생성

1 / 2

Atlas Antibodies Anti-RCN1 Antibody

상품 한눈에 보기

Human RCN1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용 분야에 적합. PrEST 항원을 이용한 Affinity 정제 방식으로 높은 특이성과 재현성 보장. Human 및 Mouse 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062104-100 Anti-RCN1 Antibody, reticulocalbin 1, EF-hand calcium binding domain 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062104-25 Anti-RCN1 Antibody, reticulocalbin 1, EF-hand calcium binding domain 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: reticulocalbin 1, EF-hand calcium binding domain

IHC (Immunohistochemistry)
WB (Western Blot, Independent Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human RCN1

FLJ37041, PIG20, Rcal, RCN

항목	내용
Target Protein	reticulocalbin 1, EF-hand calcium binding domain
Target Gene	RCN1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse
Interspecies Information	Rat ENSRNOG00000013452 (92%), Mouse ENSMUSG00000005973 (92%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

LGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQA

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet

Enhanced Validation
IHC
WB Independent
Independent Validation Tooltip
ICC

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.