CacheBy
Atlas Antibodies Anti-RC3H1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RC3H1 Antibody

상품 한눈에 보기

Human RC3H1 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 40% glycerol/PBS buffer에 보존되어 장기 보관이 용이합니다.

카탈로그번호
HPA027434-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027434-100 Anti-RC3H1 Antibody, ring finger and CCCH-type domains 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027434-25 Anti-RC3H1 Antibody, ring finger and CCCH-type domains 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RC3H1 Antibody

Anti-RC3H1 Antibody

Target: Ring finger and CCCH-type domains 1 (RC3H1)
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against Human RC3H1.

Alternative Gene Names

KIAA2025, RNF198, roquin, RP5-1198E17.5

Open Datasheet

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Target Information

  • Target Protein: Ring finger and CCCH-type domains 1
  • Target Gene: RC3H1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RTSKTIYQGAGPMQAMAPQGAPTKSINISDYSPYGTHGGWGASPYSPHQNIPSQGHFSERERISMSEVASHGKPLPSAEREQLRLELQQLNHQISQQTQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000040423 87%
Rat ENSRNOG00000009196 34%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.