CacheBy
Atlas Antibodies Anti-RBM48 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RBM48 Antibody

상품 한눈에 보기

인간 RBM48 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit에서 생산되었으며 IgG 아이소타입입니다. PrEST 항원을 이용해 친화 정제되었고, PBS와 글리세롤 버퍼에 보존제를 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021777-100 Anti-RBM48 Antibody, RNA binding motif protein 48 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021777-25 Anti-RBM48 Antibody, RNA binding motif protein 48 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RBM48 Antibody

Anti-RBM48 Antibody

Target Information

  • Target Protein: RNA binding motif protein 48
  • Target Gene: RBM48
  • Alternative Gene Names: C7orf64, DKFZp564O0523, HSPC304

Product Description

Polyclonal antibody against human RBM48, produced in rabbit.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    MDEQSFFGGLLHVCYAPEFETVEETRKKLQMRKAYVVKTTENKDHYVTKKKLVTEHKDTEDFRQDFHSEMSGF

Species Reactivity

  • Verified Species: Human
  • Interspecies Information:
    • Rat ENSRNOG00000008980 (75%)
    • Mouse ENSMUSG00000040302 (73%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (Sodium Azide)
Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.