Thermo Fisher Scientific SFN Monoclonal Antibody (3C3)
Human SFN 단백질을 인식하는 mouse monoclonal antibody(3C3)로, Western blot, IHC, ELISA, IP에 적합합니다. Affinity chromatography로 정제되었으며, PBS(pH 7.4)에 보존제 없이 액상 형태로 제공됩니다. 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific SFN Monoclonal Antibody (3C3)
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1–5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 5 µg/mL |
| ELISA | 10 µg/mL |
| Immunoprecipitation (IP) | 1–5 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host/Isotype | Mouse / IgG1, kappa |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 3C3 |
| Immunogen | SFN (AAH00329.1, amino acids 1–248) full-length recombinant protein with GST tag (GST tag MW: 26 kDa) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | See Label |
| Purification | Affinity chromatography |
| Storage Buffer | PBS, pH 7.4 |
| Contains | No preservative |
| Storage Conditions | -20°C, avoid freeze/thaw cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
Protein sequence:
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Target Information
This gene encodes a cell cycle checkpoint protein that binds to translation and initiation factors, functioning as a regulator of mitotic translation. In response to DNA damage, it helps prevent DNA errors during mitosis.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.