Atlas Antibodies Anti-RBM12B Antibody

상품 한눈에 보기

Human RBM12B 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 Western Blot에 적합하며 PrEST 항원으로 정제됨. 높은 인간 특이성과 안정적인 PBS/glycerol buffer 구성.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA053050-100 Anti-RBM12B Antibody, RNA binding motif protein 12B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA053050-25 Anti-RBM12B Antibody, RNA binding motif protein 12B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: RNA binding motif protein 12B (RBM12B)
Type: Polyclonal Antibody against Human RBM12B
Supplier: Atlas Antibodies

Polyclonal antibody targeting human RBM12B, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.

항목	내용
Target Protein	RNA binding motif protein 12B
Target Gene	RBM12B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000052137 (74%), Rat ENSRNOG00000055292 (74%)

Antigen Sequence:
NLSLSIDERDLRNFFRGTDLTDEQIRFLYKDENRTRYAFVMFKTLKDYNTALSLHKTVLQYRPVHIDPISRKQMLKFIARYEKK

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Determine optimal concentration and conditions per application.