Atlas Antibodies Anti-RBL1 Antibody

상품 한눈에 보기

Human RBL1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG로 PrEST 항원 친화 정제 방식 사용. Human 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054962-100 Anti-RBL1 Antibody, retinoblastoma-like 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054962-25 Anti-RBL1 Antibody, retinoblastoma-like 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: retinoblastoma-like 1
Supplier: Atlas Antibodies

Validation:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human RBL1

항목	내용
Target Protein	retinoblastoma-like 1
Target Gene	RBL1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	ESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHER
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000006921 (86%), Mouse ENSMUSG00000027641 (86%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.