Atlas Antibodies Anti-RBKS Antibody

상품 한눈에 보기

Human RBKS 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal 및 recombinant expression 검증을 통해 높은 특이성과 신뢰성을 제공합니다. Rabbit 유래 IgG 항체로, PrEST 항원을 이용해 친화 정제되었습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019725-100 Anti-RBKS Antibody, ribokinase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019725-25 Anti-RBKS Antibody, ribokinase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RBKS Antibody

Anti-RBKS Antibody

Target Protein: ribokinase
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant expression): Recombinant expression validation in WB using target protein overexpression.
ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal Antibody against Human RBKS

Alternative Gene Names

DKFZp686G13268, RBSK

Open Datasheet

Antigen Information

Target Gene: RBKS

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

CQVVIITLGAEGCVVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLSLEDMLNRSNFIAAVSVQAAGTQSSYPYKKDLPLTLF

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000029136	89%
Rat	ENSRNOG00000004710	87%

Antibody Characteristics

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet