Atlas Antibodies Anti-RBBP4 Antibody

상품 한눈에 보기

인간 RBBP4 단백질을 인식하는 토끼 폴리클로날 항체. retinoblastoma binding protein 4 검출용. 100% 쥐 및 생쥐 상동체 반응성 확인. PrEST 항원으로 친화 정제된 고품질 항체. 면역세포화학 등 연구용 적용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA060724-100 Anti-RBBP4 Antibody, retinoblastoma binding protein 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA060724-25 Anti-RBBP4 Antibody, retinoblastoma binding protein 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Retinoblastoma binding protein 4 (RBBP4)

Polyclonal antibody against human RBBP4.

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

IIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHT

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage	Gently mix before use. Optimal concentrations and conditions should be determined by the user.