AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RASGRP3 Antibody
상품 한눈에 보기
인간 RASGRP3 단백질을 인식하는 폴리클로날 항체로, 면역세포 신호전달 연구에 적합합니다. 토끼에서 생산된 IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 반응성이 검증되었고, 글리세롤/PBS 완충액에 보존되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058937-100 Anti-RASGRP3 Antibody, RAS guanyl releasing protein 3 (calcium and DAG-regulated) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058937-25 Anti-RASGRP3 Antibody, RAS guanyl releasing protein 3 (calcium and DAG-regulated) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RASGRP3 Antibody
Anti-RASGRP3 Antibody
RAS guanyl releasing protein 3 (calcium and DAG-regulated)
Recommended Applications
ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human RASGRP3.
Alternative Gene Names
- GRP3
- KIAA0846
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | RAS guanyl releasing protein 3 (calcium and DAG-regulated) |
| Target Gene | RASGRP3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | RYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDHLE |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000071042 (93%), Rat ENSRNOG00000032703 (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.