CacheBy
Atlas Antibodies Anti-RASGRF2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RASGRF2 Antibody

상품 한눈에 보기

사람 RASGRF2 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산되었습니다. 면역조직화학 등 다양한 연구용 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 글리세롤 기반 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018679-100 Anti-RASGRF2 Antibody, Ras protein-specific guanine nucleotide-releasing factor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018679-25 Anti-RASGRF2 Antibody, Ras protein-specific guanine nucleotide-releasing factor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RASGRF2 Antibody

Anti-RASGRF2 Antibody

Ras protein-specific guanine nucleotide-releasing factor 2

면역조직화학(IHC) 등 다양한 연구용 응용에 적합

Product Description

Polyclonal Antibody against Human RASGRF2

Alternative Gene Names

  • GRF2
  • Ras-GRF2

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Ras protein-specific guanine nucleotide-releasing factor 2
Target Gene RASGRF2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVD
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000021708 (72%), Rat ENSRNOG00000056151 (71%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.