CacheBy
Atlas Antibodies Anti-RARS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RARS2 Antibody

상품 한눈에 보기

Human RARS2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증된 반응성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042645-100 Anti-RARS2 Antibody, arginyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042645-25 Anti-RARS2 Antibody, arginyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RARS2 Antibody

Anti-RARS2 Antibody

Target: arginyl-tRNA synthetase 2, mitochondrial
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human RARS2.


Alternative Gene Names

DALRD2, dJ382I10.6, MGC14993, MGC23778, PRO1992, RARSL

Open Datasheet (PDF)


Target Information

  • Target Protein: arginyl-tRNA synthetase 2, mitochondrial
  • Target Gene: RARS2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LSVDSLLEKDNDHSRPDIQVQAKRLAEKLRCDTVVSEISTGQRTVNFKINRELLTKTVLQQVIEDGSKYGLKSELFSGLP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000028292 76%
Rat ENSRNOG00000008643 75%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.