CacheBy
Atlas Antibodies Anti-RAPGEF6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RAPGEF6 Antibody

상품 한눈에 보기

인간 RAPGEF6 단백질을 인식하는 토끼 폴리클로날 항체. 면역조직화학 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 대해 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037983-100 Anti-RAPGEF6 Antibody, Rap guanine nucleotide exchange factor (GEF) 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037983-25 Anti-RAPGEF6 Antibody, Rap guanine nucleotide exchange factor (GEF) 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RAPGEF6 Antibody

Anti-RAPGEF6 Antibody

Target: Rap guanine nucleotide exchange factor (GEF) 6
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human RAPGEF6.

Alternative Gene Names

PDZ-GEF2, PDZGEF2, RA-GEF-2

Immunohistochemistry (IHC)


Target Information

항목 내용
Target Protein Rap guanine nucleotide exchange factor (GEF) 6
Target Gene RAPGEF6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SNCSVDSMSAALQDERCSSQALAVPESTGALEKTEHASGIGDHSQHGPGWTLLKPSLIKCLAVSSSVSNEEISQEHIIIEAADS
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000037533 (73%), Rat ENSRNOG00000009995 (73%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.