AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RAPGEF1 Antibody
상품 한눈에 보기
인간 RAPGEF1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB(재조합 발현) 검증 완료. 높은 종간 보존성(인간-쥐 99%). PrEST 항원을 이용한 친화 정제. PBS/glycerol 완충액에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA006426-100 Anti-RAPGEF1 Antibody, Rap guanine nucleotide exchange factor (GEF) 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006426-25 Anti-RAPGEF1 Antibody, Rap guanine nucleotide exchange factor (GEF) 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RAPGEF1 Antibody
Anti-RAPGEF1 Antibody
Rap guanine nucleotide exchange factor (GEF) 1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (Recombinant Expression)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human RAPGEF1
Alternative Gene Names
- C3G
- GRF2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Rap guanine nucleotide exchange factor (GEF) 1 |
| Target Gene | RAPGEF1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SWLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQNDPRIQHSSALSSCYSRVYQSLANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSSPASK |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to:
- Rat ENSRNOG00000014316 (99%)
- Mouse ENSMUSG00000039844 (99%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.