
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RANGRF Antibody
상품 한눈에 보기
Human RANGRF 단백질을 인식하는 Rabbit polyclonal 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, Human에 대한 반응성이 검증됨. 안정화 용액은 40% glycerol과 PBS(pH 7.2) 기반.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057888-100 Anti-RANGRF Antibody, RAN guanine nucleotide release factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057888-25 Anti-RANGRF Antibody, RAN guanine nucleotide release factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RANGRF Antibody
Anti-RANGRF Antibody
RAN guanine nucleotide release factor
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human RANGRF.
Alternative Gene Names
HSPC165, HSPC236, MOG1, RANGNRF
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | RAN guanine nucleotide release factor |
| Target Gene | RANGRF |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Epitope Sequence:
MEPTRDCPLFGGAFSAILPMGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGRCQEAWVLSGKQQIAK
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000032892 (88%)
- Rat ENSRNOG00000004980 (88%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



