CacheBy
Atlas Antibodies Anti-RANBP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RANBP2 Antibody

상품 한눈에 보기

Human RANBP2 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 안정적인 PBS/glycerol 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023960-100 Anti-RANBP2 Antibody, RAN binding protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023960-25 Anti-RANBP2 Antibody, RAN binding protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RANBP2 Antibody

Anti-RANBP2 Antibody

Target Information

  • Target Protein: RAN binding protein 2
  • Target Gene: RANBP2
  • Alternative Gene Names: ADANE, ANE1, NUP358

이미지 내 텍스트: IHC (Immunohistochemistry)

Product Description

Polyclonal antibody against Human RANBP2.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SNSESLLGLLTSDKPLQGDGYSGAKPIPGGQTIGPRNTFNFGSKNVSGISFTENMGSSQQKNSGFRRSDDMFTFHGPGKSVFGTPTL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity (%)
Rat ENSRNOG00000000796 77%
Mouse ENSMUSG00000003226 75%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.