
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RALGAPA2 Antibody
상품 한눈에 보기
Human RALGAPA2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합. PrEST 항원을 이용해 친화정제되었으며, 높은 특이성과 재현성을 제공. Human에 반응하며, Mouse와 Rat에서 높은 상동성을 보임.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043622-100 Anti-RALGAPA2 Antibody, Ral GTPase activating protein, alpha subunit 2 (catalytic) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043622-25 Anti-RALGAPA2 Antibody, Ral GTPase activating protein, alpha subunit 2 (catalytic) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RALGAPA2 Antibody
Anti-RALGAPA2 Antibody
Ral GTPase activating protein, alpha subunit 2 (catalytic)
Recommended Applications
- IHC (Immunohistochemistry)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human RALGAPA2
Alternative Gene Names
AS250, C20orf74, dJ1049G11.4, KIAA1272, RapGAPalpha2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Ral GTPase activating protein, alpha subunit 2 (catalytic) |
| Target Gene | RALGAPA2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | CLAPNGRNPSFLISSWHRDTFGPQKDSSQVEEGDDVLDKLLENIGHTSPECLLPSQLNLNEPSLTPCGMNYDQEKEIIEVILRQNAQEDEYIQSHNFDSAMKVT |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000037110 | 78% |
| Rat | ENSRNOG00000036964 | 75% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



