Atlas Antibodies Anti-RABL3 Antibody

상품 한눈에 보기

Human RABL3 단백질을 타겟으로 하는 폴리클로날 래빗 항체. IHC 및 ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human에 대해 검증된 반응성.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035151-100 Anti-RABL3 Antibody, RAB, member of RAS oncogene family-like 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035151-25 Anti-RABL3 Antibody, RAB, member of RAS oncogene family-like 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: RAB, member of RAS oncogene family-like 3
Supplier: Atlas Antibodies

Polyclonal antibody against Human RABL3.

Target Protein: RAB, member of RAS oncogene family-like 3
Target Gene: RABL3
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

KSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHD

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity (%)
Rat	ENSRNOG00000026085	96%
Mouse	ENSMUSG00000022827	96%

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand