CacheBy
Atlas Antibodies Anti-RABGAP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RABGAP1 Antibody

상품 한눈에 보기

Human RABGAP1 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합합니다. Rabbit 호스트에서 생산된 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. Human에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA072273-100 Anti-RABGAP1 Antibody, RAB GTPase activating protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA072273-25 Anti-RABGAP1 Antibody, RAB GTPase activating protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RABGAP1 Antibody

Anti-RABGAP1 Antibody

Target Information

  • Target Protein: RAB GTPase activating protein 1
  • Target Gene: RABGAP1
  • Alternative Gene Names: GAPCenA, TBC1D11

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    RICQQHTKDISERQARFSSQSGETGEVQACPDKRYAM

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000053164 89%
Rat ENSRNOG00000042269 89%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

IHC (Immunohistochemistry)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.