CacheBy
Atlas Antibodies Anti-RABEP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RABEP1 Antibody

상품 한눈에 보기

Human RABEP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 검증됨. PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 및 독립 항체 비교를 통한 정밀 검증 수행. Human에 반응하며 Mouse, Rat과 높은 상동성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024235-100 Anti-RABEP1 Antibody, rabaptin, RAB GTPase binding effector protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024235-25 Anti-RABEP1 Antibody, rabaptin, RAB GTPase binding effector protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RABEP1 Antibody

Anti-RABEP1 Antibody

Target: rabaptin, RAB GTPase binding effector protein 1
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직 간의 발현을 검증함.
  • WB (Independent validation): 서로 다른 에피토프를 인식하는 독립 항체 간의 단백질 발현 비교를 통해 검증함.

Product Description

Polyclonal antibody against Human RABEP1


Alternative Gene Names

neurocrescin, RAB5EP, rabaptin-5, RABPT5

Open Datasheet


Specifications

항목 내용
Target Protein rabaptin, RAB GTPase binding effector protein 1
Target Gene RABEP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SREQVSEELVRLQKDNDSLQGKHSLHVSLQQAEDFILPDTTEALRELVLKYREDIINVRTAADHVEEKLKAEILFLKEQIQAEQCLKENLEETLQL
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000020817 (93%), Rat ENSRNOG00000005015 (92%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB Independent
Independent Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.