Atlas Antibodies Anti-RAB5C Antibody

상품 한눈에 보기

인간 RAB5C 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. RNA-seq 데이터 기반 정교한 Orthogonal 검증이 수행되었습니다. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA004167-100 Anti-RAB5C Antibody, RAB5C, member RAS oncogene family 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA004167-25 Anti-RAB5C Antibody, RAB5C, member RAS oncogene family 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RAB5C Antibody

Anti-RAB5C Antibody

RAB5C, member RAS oncogene family

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot, Orthogonal validation)

Orthogonal validation:
Protein expression verified by WB in comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against Human RAB5C.

Alternative Gene Names

RAB5CL, RABL

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	RAB5C, member RAS oncogene family
Target Gene	RAB5C
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
Verified Species Reactivity	Human
Interspecies Identity	Rat (97%, ENSRNOG00000018568), Mouse (95%, ENSMUSG00000019173)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand