Atlas Antibodies Anti-RAB43 Antibody

상품 한눈에 보기

Human RAB43 단백질을 타겟으로 하는 토끼 폴리클로날 항체. IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal 검증 제공. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 확보. Human에 반응성이 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA060085-100 Anti-RAB43 Antibody, RAB43, member RAS oncogene family 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA060085-25 Anti-RAB43 Antibody, RAB43, member RAS oncogene family 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: RAB43, member of RAS oncogene family
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human RAB43.

ISY1, RAB11B, RAB41

항목	내용
Target Protein	RAB43, member RAS oncogene family
Target Gene	RAB43
Antigen Sequence	EAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGW
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000030055 (82%), Rat ENSRNOG00000037768 (82%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.