Atlas Antibodies Anti-RAB41 Antibody

상품 한눈에 보기

Rabbit polyclonal antibody targeting human RAB41 protein, a member of the RAS oncogene family. Affinity purified using PrEST antigen. Suitable for immunohistochemistry and other applications. Supplied in PBS with glycerol and sodium azide preservative.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001510-100 Anti-RAB41 Antibody, RAB41, member RAS oncogene family 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001510-25 Anti-RAB41 Antibody, RAB41, member RAS oncogene family 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RAB41 Antibody

Anti-RAB41 Antibody

Target Information

Target Protein: RAB41, member RAS oncogene family
Target Gene: RAB41
Verified Species Reactivity: Human
Interspecies Information:
- Rat ENSRNOG00000018176 (73%)
- Mouse ENSMUSG00000032549 (73%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GKTSIISRFMYNSFGCACQATVGIDFLSKTMYLEDQIVQLQLWDTAGQERFHSLIPSYIRDSTIAVVVYDITNINSFKETDKWVEHVRAERGDDVVIMLLGNKIDLDNKRQVTAEQGEEKSRNLNVMFIETSAKTGYNVKKVI

Product Description

Polyclonal antibody against human RAB41.
Recommended for immunohistochemistry and related applications.

Open Datasheet (PDF)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Recommended Applications	Immunohistochemistry (IHC)
Safety Information	Material Safety Data Sheet