
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RAB11FIP1 Antibody
상품 한눈에 보기
Human RAB11FIP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, RNA-seq 데이터 기반의 정교한 정합 검증 수행. 고순도 Affinity 정제 및 안정한 PBS/glycerol buffer 제공.
- 카탈로그번호
- HPA023904-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023904-100 Anti-RAB11FIP1 Antibody, RAB11 family interacting protein 1 (class I) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023904-25 Anti-RAB11FIP1 Antibody, RAB11 family interacting protein 1 (class I) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RAB11FIP1 Antibody
Anti-RAB11FIP1 Antibody
RAB11 family interacting protein 1 (class I)
Recommended Applications
- Immunohistochemistry (IHC) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human RAB11FIP1
Alternative Gene Names
FLJ22524, FLJ22622, Rab11-FIP1, RCP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | RAB11 family interacting protein 1 (class I) |
| Target Gene | RAB11FIP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TGSAKHRLHPVKPMNAMATKVANCSLGTATIISENLNNEVMMKKYSPSDPAFAYAQLTHDELIQLVLKQKETISKKEFQVR |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000031488 (84%)
- Rat ENSRNOG00000058940 (84%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



