CacheBy
Atlas Antibodies Anti-RAB11FIP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RAB11FIP1 Antibody

상품 한눈에 보기

Human RAB11FIP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, RNA-seq 데이터 기반의 정교한 정합 검증 수행. 고순도 Affinity 정제 및 안정한 PBS/glycerol buffer 제공.

카탈로그번호
HPA023904-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023904-100 Anti-RAB11FIP1 Antibody, RAB11 family interacting protein 1 (class I) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023904-25 Anti-RAB11FIP1 Antibody, RAB11 family interacting protein 1 (class I) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RAB11FIP1 Antibody

Anti-RAB11FIP1 Antibody

RAB11 family interacting protein 1 (class I)


  • Immunohistochemistry (IHC) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human RAB11FIP1


Alternative Gene Names

FLJ22524, FLJ22622, Rab11-FIP1, RCP

Open Datasheet


Target Information

항목 내용
Target Protein RAB11 family interacting protein 1 (class I)
Target Gene RAB11FIP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TGSAKHRLHPVKPMNAMATKVANCSLGTATIISENLNNEVMMKKYSPSDPAFAYAQLTHDELIQLVLKQKETISKKEFQVR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000031488 (84%)
  • Rat ENSRNOG00000058940 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.