CacheBy
Atlas Antibodies Anti-QRSL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2
Atlas Antibodies

Atlas Antibodies Anti-QRSL1 Antibody

상품 한눈에 보기

인간 QRSL1 단백질을 인식하는 폴리클로날 래빗 항체로, IHC 및 WB에 적합합니다. PrEST 항원으로 친화 정제되었으며 인간, 마우스, 랫트 반응성이 검증되었습니다. 안정적인 PBS/glycerol 버퍼에 보존되어 연구용으로 최적화된 제품입니다.

브랜드
Atlas Antibodies
카테고리
Polyclonal Antibodies
판매단위
100ul, 25ul
#Antibodies#Atlas Antibodies

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029587-100 Anti-QRSL1 Antibody, glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029587-25 Anti-QRSL1 Antibody, glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-QRSL1 Antibody

Anti-QRSL1 Antibody

Target Protein: glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Validation: Independent antibody validation by comparing different epitopes of the protein in WB.

Product Description

Polyclonal antibody against Human QRSL1.

Alternative Gene Names

DKFZP564C1278, FLJ10989, FLJ12189, FLJ13447, GatA

Open Datasheet

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence 

ELSSEVQSLWSKAADLFESEGAKVIEVSLPHTSYSIVCYHVLCTSEVASNMARFDGLQYGHRCDIDVSTEAMYAATRREGFNDVVRGRILSGNF

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000019863 93%
Rat ENSRNOG00000026049 84%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기
Atlas AntibodiesAtlas Antibodies Anti-QDPR Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-QDPR Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-QRSL1 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-QRICH2 Antibody528,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.