CacheBy
Atlas Antibodies Anti-PYGL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PYGL Antibody

상품 한눈에 보기

Human PYGL 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터와 비교한 정교한 정합 검증을 거침. 고순도 친화정제 항체로 다양한 종에서 높은 상동성을 보임. 글리세롤 기반 보존액 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004119-100 Anti-PYGL Antibody, phosphorylase, glycogen, liver 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004119-25 Anti-PYGL Antibody, phosphorylase, glycogen, liver 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PYGL Antibody

Anti-PYGL Antibody

Target: phosphorylase, glycogen, liver (PYGL)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

  • ICC (Immunocytochemistry)


Product Description

Polyclonal Antibody against Human PYGL
Open Datasheet


Antigen Information

Antigen Sequence (PrEST):

MRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD

Verified Species Reactivity

  • Human

Interspecies Information:
| Species | Gene ID | Sequence Identity |
|----------|----------|------------------|
| Mouse | ENSMUSG00000021069 | 94% |
| Rat | ENSRNOG00000006388 | 92% |


Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.