CacheBy
Atlas Antibodies Anti-PYGL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PYGL Antibody

상품 한눈에 보기

Human PYGL 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터와 비교한 정교한 정합 검증을 거침. 고순도 친화정제 항체로 다양한 종에서 높은 상동성을 보임. 글리세롤 기반 보존액 포함.

카탈로그번호
HPA004119-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004119-100 Anti-PYGL Antibody, phosphorylase, glycogen, liver 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004119-25 Anti-PYGL Antibody, phosphorylase, glycogen, liver 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PYGL Antibody

Anti-PYGL Antibody

Target: phosphorylase, glycogen, liver (PYGL)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

  • ICC (Immunocytochemistry)


Product Description

Polyclonal Antibody against Human PYGL
Open Datasheet


Antigen Information

Antigen Sequence (PrEST):

MRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD

Verified Species Reactivity

  • Human

Interspecies Information:
| Species | Gene ID | Sequence Identity |
|----------|----------|------------------|
| Mouse | ENSMUSG00000021069 | 94% |
| Rat | ENSRNOG00000006388 | 92% |


Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.