CacheBy
Atlas Antibodies Anti-PUSL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PUSL1 Antibody

상품 한눈에 보기

Human PUSL1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도의 IgG 형태로 제공됩니다. 인간에 특이적이며, 실험 조건 최적화가 필요합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039999-100 Anti-PUSL1 Antibody, pseudouridylate synthase-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039999-25 Anti-PUSL1 Antibody, pseudouridylate synthase-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PUSL1 Antibody

Anti-PUSL1 Antibody

Target: pseudouridylate synthase-like 1 (PUSL1)
Type: Polyclonal Antibody against Human PUSL1

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against human PUSL1 (pseudouridylate synthase-like 1).
It is affinity purified using the PrEST antigen as affinity ligand.

Alternative Gene Names

  • FLJ90811

Open Datasheet (PDF)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

WTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNLEFESQSFLY

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000051557 80%
Rat ENSRNOG00000022354 78%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.