CacheBy
Atlas Antibodies Anti-PUS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PUS1 Antibody

상품 한눈에 보기

Human PUS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC와 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응성(쥐·마우스 95%)을 보입니다. 40% 글리세롤/PBS 완충액에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051636-100 Anti-PUS1 Antibody, pseudouridylate synthase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051636-25 Anti-PUS1 Antibody, pseudouridylate synthase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PUS1 Antibody

Anti-PUS1 Antibody

Target Information

  • Target Protein: pseudouridylate synthase 1
  • Target Gene: PUS1
  • Verified Species Reactivity: Human
  • Interspecies Identity: Rat (95%), Mouse (95%)

Product Description

Polyclonal antibody against Human PUS1.

Open Datasheet

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    PQDPSACRYILEMYCEEPFVREGLEFAVIRVKGQSFMMHQIRKMVGLVVAIVKGYAPESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFG

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Applications IHC, WB
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.
MSDS Material Safety Data Sheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.