CacheBy
Atlas Antibodies Anti-PURG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PURG Antibody

상품 한눈에 보기

Human PURG 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 정제되었으며, 높은 종간 보존성을 가집니다. 안정한 PBS/glycerol buffer에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047746-100 Anti-PURG Antibody, purine-rich element binding protein G 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047746-25 Anti-PURG Antibody, purine-rich element binding protein G 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PURG Antibody

Anti-PURG Antibody

Purine-rich element binding protein G

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human PURG.

Alternative Gene Names

  • PURG-A
  • PURG-B

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Purine-rich element binding protein G
Target Gene PURG
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASK

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000015426 92%
Mouse ENSMUSG00000049184 90%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.