CacheBy
Atlas Antibodies Anti-PTRH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTRH1 Antibody

상품 한눈에 보기

Human PTRH1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식. Human에 대한 반응성이 검증되었으며, Mouse 및 Rat에서도 높은 상동성을 가짐. 40% 글리세롤 기반 PBS 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021223-100 Anti-PTRH1 Antibody, peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021223-25 Anti-PTRH1 Antibody, peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTRH1 Antibody

Anti-PTRH1 Antibody

Target: peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human PTRH1.

Alternative Gene Names

  • C9orf115
  • PTH1

Open Datasheet

Target Information

항목 내용
Target Protein peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae)
Target Gene PTRH1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000053746 84%
Rat ENSRNOG00000049034 84%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.