CacheBy
Atlas Antibodies Anti-PTRF Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTRF Antibody

상품 한눈에 보기

Human PTRF 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Recombinant expression으로 검증되었으며, PrEST 항원을 이용해 Affinity 정제되었습니다. Human에 반응하며, cavin-1(CAVIN1) 대체명으로도 알려져 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049838-100 Anti-PTRF Antibody, polymerase I and transcript release factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049838-25 Anti-PTRF Antibody, polymerase I and transcript release factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTRF Antibody

Anti-PTRF Antibody

Target: Polymerase I and transcript release factor (PTRF)
Type: Polyclonal Antibody against Human PTRF
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Recombinant expression validation using target protein overexpression
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in Rabbit against Human PTRF (polymerase I and transcript release factor).


Alternative Gene Names

  • cavin-1
  • CAVIN1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein polymerase I and transcript release factor
Target Gene PTRF
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDKIIGAVDQIQLTQAQLEERQAEMEGAVQSIQGELSKLGK
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000004044 (89%)
Rat ENSRNOG00000019778 (89%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Recombinant Expression Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.