
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PTPRE Antibody
상품 한눈에 보기
Human PTPRE 단백질에 대한 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC 및 ICC 적용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 높은 종 간 서열 유사성(96~98%)을 가지며, 안정적인 PBS/glycerol buffer로 제공됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA015870-100 Anti-PTPRE Antibody, protein tyrosine phosphatase, receptor type, E 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015870-25 Anti-PTPRE Antibody, protein tyrosine phosphatase, receptor type, E 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PTPRE Antibody
Anti-PTPRE Antibody
Target: Protein tyrosine phosphatase, receptor type, E
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human PTPRE.
Alternative Gene Names
- PTPE
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Protein tyrosine phosphatase, receptor type, E |
| Target Gene | PTPRE |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (98%), Mouse (96%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
NGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGPKQENotes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Reference Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



