
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PTPN2 Antibody
상품 한눈에 보기
Human PTPN2 단백질을 인식하는 토끼 다클론 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인간 단백질 발현 검증에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA046176-100 Anti-PTPN2 Antibody, protein tyrosine phosphatase, non-receptor type 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046176-25 Anti-PTPN2 Antibody, protein tyrosine phosphatase, non-receptor type 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PTPN2 Antibody
Anti-PTPN2 Antibody
Protein tyrosine phosphatase, non-receptor type 2
Recommended Applications
- IHC (Independent antibody validation)
단백질의 서로 다른 에피토프를 인식하는 독립 항체를 비교하여 IHC에서의 단백질 발현을 검증. - WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human PTPN2
Alternative Gene Names
PTPT, TC-PTP, TCELLPTP, TCPTP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein tyrosine phosphatase, non-receptor type 2 |
| Target Gene | PTPN2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKATTAQKVQQMKQRLNENERK |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000024539 | 81% |
| Rat | ENSRNOG00000017453 | 68% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야별 최적 농도와 조건은 사용자가 직접 확인해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



