CacheBy
Atlas Antibodies Anti-PTN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTN Antibody

상품 한눈에 보기

Human PTN 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 연구용 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응성과 신뢰성 있는 검출을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA073913-100 Anti-PTN Antibody, pleiotrophin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073913-25 Anti-PTN Antibody, pleiotrophin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTN Antibody

Anti-PTN Antibody

Target Information

  • Target Protein: pleiotrophin
  • Target Gene: PTN
  • Alternative Gene Names: HBGF8, HBNF, NEGF1

Product Description

Polyclonal antibody against Human PTN (pleiotrophin).
Recommended for use in various immunoassays.

Antigen Information

  • Antigen Sequence:
    Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    KQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000029838): 98%
  • Rat (ENSRNOG00000011946): 98%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.