CacheBy
Atlas Antibodies Anti-PTN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTN Antibody

상품 한눈에 보기

Human PTN 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 연구용 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응성과 신뢰성 있는 검출을 제공합니다.

카탈로그번호
HPA073913-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073913-100 Anti-PTN Antibody, pleiotrophin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073913-25 Anti-PTN Antibody, pleiotrophin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTN Antibody

Anti-PTN Antibody

Target Information

  • Target Protein: pleiotrophin
  • Target Gene: PTN
  • Alternative Gene Names: HBGF8, HBNF, NEGF1

Product Description

Polyclonal antibody against Human PTN (pleiotrophin).
Recommended for use in various immunoassays.

Antigen Information

  • Antigen Sequence:
    Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    KQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000029838): 98%
  • Rat (ENSRNOG00000011946): 98%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.