CacheBy
Atlas Antibodies Anti-PTCHD1 Antibody
원본

Atlas Antibodies Anti-PTCHD1 Antibody

상품 한눈에 보기

Human PTCHD1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며 Rat, Mouse와 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA046110-100 Anti-PTCHD1 Antibody, patched domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046110-25 Anti-PTCHD1 Antibody, patched domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTCHD1 Antibody

Anti-PTCHD1 Antibody

Target: patched domain containing 1 (PTCHD1)
Supplier: Atlas Antibodies


Immunohistochemistry (IHC)


Product Description

Polyclonal antibody against human PTCHD1.


Alternative Gene Names

  • FLJ30296

Open Datasheet


Target Information

항목 내용
Target Protein patched domain containing 1
Target Gene PTCHD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FTGYIENNYQHSIFCRKVPKPEALQEKPAWYRFLLTARFSEDTAEGEEANTYESHLLVCFLKRYYCDWITNT

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000003675 99%
Mouse ENSMUSG00000041552 96%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.