
원본
Atlas Antibodies Anti-PTCHD1 Antibody
상품 한눈에 보기
Human PTCHD1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며 Rat, Mouse와 높은 서열 유사성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA046110-100 Anti-PTCHD1 Antibody, patched domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046110-25 Anti-PTCHD1 Antibody, patched domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PTCHD1 Antibody
Anti-PTCHD1 Antibody
Target: patched domain containing 1 (PTCHD1)
Supplier: Atlas Antibodies
Recommended Applications
Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human PTCHD1.
Alternative Gene Names
- FLJ30296
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | patched domain containing 1 |
| Target Gene | PTCHD1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | FTGYIENNYQHSIFCRKVPKPEALQEKPAWYRFLLTARFSEDTAEGEEANTYESHLLVCFLKRYYCDWITNT |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000003675 | 99% |
| Mouse | ENSMUSG00000041552 | 96% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



