CacheBy
Atlas Antibodies Anti-PTCD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTCD2 Antibody

상품 한눈에 보기

인간 PTCD2 단백질을 인식하는 고품질 폴리클로날 항체입니다. Rabbit 호스트 기반 IgG 형식으로 제작되었으며, IHC 및 Western Blot에 추천됩니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA043686-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043686-100 Anti-PTCD2 Antibody, pentatricopeptide repeat domain 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043686-25 Anti-PTCD2 Antibody, pentatricopeptide repeat domain 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTCD2 Antibody

Anti-PTCD2 Antibody

Target: Pentatricopeptide repeat domain 2 (PTCD2)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human PTCD2.

Alternative Gene Names

  • FLJ12598

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Pentatricopeptide repeat domain 2
Target Gene PTCD2
Verified Species Reactivity Human
Interspecies Identity Rat (81%), Mouse (75%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIHIQSNMLENLIKTLK

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Recommended Application
WB Recommended Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.