CacheBy
Atlas Antibodies Anti-PTCD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTCD2 Antibody

상품 한눈에 보기

인간 PTCD2 단백질을 인식하는 고품질 폴리클로날 항체입니다. Rabbit 호스트 기반 IgG 형식으로 제작되었으며, IHC 및 Western Blot에 추천됩니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA043686-100 Anti-PTCD2 Antibody, pentatricopeptide repeat domain 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043686-25 Anti-PTCD2 Antibody, pentatricopeptide repeat domain 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTCD2 Antibody

Anti-PTCD2 Antibody

Target: Pentatricopeptide repeat domain 2 (PTCD2)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human PTCD2.

Alternative Gene Names

  • FLJ12598

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Pentatricopeptide repeat domain 2
Target Gene PTCD2
Verified Species Reactivity Human
Interspecies Identity Rat (81%), Mouse (75%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIHIQSNMLENLIKTLK

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Recommended Application
WB Recommended Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.