CacheBy
Atlas Antibodies Anti-PSRC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSRC1 Antibody

상품 한눈에 보기

Human PSRC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. DDA3로도 알려진 PSRC1을 표적으로 하며, PrEST 항원으로 친화 정제되었습니다. 사람에 대해 검증되었으며, 글리세롤 기반 완충액에 보존됩니다.

카탈로그번호
HPA049315-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049315-100 Anti-PSRC1 Antibody, proline/serine-rich coiled-coil 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049315-25 Anti-PSRC1 Antibody, proline/serine-rich coiled-coil 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSRC1 Antibody

Anti-PSRC1 Antibody

Target: proline/serine-rich coiled-coil 1 (PSRC1)
Alternative Gene Name: DDA3
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal antibody against human PSRC1 protein.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.


Target Information

항목 내용
Target Protein proline/serine-rich coiled-coil 1
Target Gene PSRC1
Alternative Gene Name DDA3
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000020013 (90%), Mouse ENSMUSG00000068744 (87%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLEEILD

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 실험에 맞게 결정해야 합니다.

Reference

Open Datasheet


제품 이미지

Recommended Application - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.