CacheBy
Atlas Antibodies Anti-CRTC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CRTC3 Antibody

상품 한눈에 보기

Human CRTC3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인체 반응성이 검증되었으며, 높은 종간 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063691-100 Anti-CRTC3 Antibody, CREB regulated transcription coactivator 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063691-25 Anti-CRTC3 Antibody, CREB regulated transcription coactivator 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CRTC3 Antibody

Anti-CRTC3 Antibody

CREB regulated transcription coactivator 3

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CRTC3

Alternative Gene Names

  • FLJ21868

Open Datasheet

Target Information

항목 내용
Target Protein CREB regulated transcription coactivator 3
Target Gene CRTC3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALN
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000011975 (93%), Mouse ENSMUSG00000030527 (91%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.