Atlas Antibodies Anti-CRTC1 Antibody

상품 한눈에 보기

Human CRTC1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit에서 생산된 IgG 항체이며, Human, Mouse, Rat에 반응. PrEST 항원을 이용해 친화 정제됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA022035-100 Anti-CRTC1 Antibody, CREB regulated transcription coactivator 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA022035-25 Anti-CRTC1 Antibody, CREB regulated transcription coactivator 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

CREB regulated transcription coactivator 1

Polyclonal antibody against Human CRTC1.

FLJ14027, KIAA0616, MECT1, TORC1

항목	내용
Target Protein	CREB regulated transcription coactivator 1
Target Gene	CRTC1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEV

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand